PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca61123.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family GATA
Protein Properties Length: 389aa    MW: 44117.1 Da    PI: 8.5705
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca61123.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.12.1e-17145177133
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkk 33 
                 C++C + kTp+WR+gp g ktLCnaCGl y+k 
  Dca61123.1 145 CVHCDSAKTPQWRNGPMGRKTLCNACGLQYKKG 177
                 *******************************95 PP

2GATA55.76.7e-18199231133
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkk 33 
                 C++C + +Tp+WR gp g+ktLCnaCG+ y+k+
  Dca61123.1 199 CVHCESASTPQWRDGPLGPKTLCNACGIQYKKR 231
                 *******************************96 PP

3GATA56.73.2e-18311344134
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                 C++C tt+Tp+WR+gp g ktLCnaCG+ yr  +
  Dca61123.1 311 CAHCETTTTPQWREGPLGRKTLCNACGVQYRNGR 344
                 *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.899139175IPR000679Zinc finger, GATA-type
SMARTSM004012.3E-15139189IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.43E-12140178No hitNo description
CDDcd002024.51E-12144199No hitNo description
Gene3DG3DSA:3.30.50.107.9E-15144177IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS003440145170IPR000679Zinc finger, GATA-type
PfamPF003205.1E-15145177IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.0E-12191236No hitNo description
SMARTSM004012.2E-14193243IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.543197229IPR000679Zinc finger, GATA-type
CDDcd002021.84E-11198249No hitNo description
Gene3DG3DSA:3.30.50.103.3E-14198231IPR013088Zinc finger, NHR/GATA-type
PfamPF003201.6E-15199231IPR000679Zinc finger, GATA-type
SMARTSM004013.2E-15305359IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.833305341IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.13E-13305356No hitNo description
Gene3DG3DSA:3.30.50.101.8E-14308344IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.15E-13310359No hitNo description
PROSITE patternPS003440311336IPR000679Zinc finger, GATA-type
PfamPF003204.6E-16311344IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MDSPEKKHEK LPIDLNKSGE EVNMEIVNQY GQLMGDFSKL DDELWLAPPA HDESLGFCSE  60
GLEWKIVSSH PHERTTEQVN NSVFDEGLVS MENNSSSNDS SQNCSSSVSP VSILRGRLVK  120
TRKIADLLQL NPMEKNPPAK LVKKCVHCDS AKTPQWRNGP MGRKTLCNAC GLQYKKGLLS  180
DYHRPLQTIK PQTEVIKKCV HCESASTPQW RDGPLGPKTL CNACGIQYKK RLLSPDYRPI  240
RNPRRNTSPP LEPAKNSSCD PYQKKDEEIM LSEKTEIDRN YTSDADDSSS DTDFKPTTRK  300
KRQPVVVDKK CAHCETTTTP QWREGPLGRK TLCNACGVQY RNGRLFPEYR PLQSPSYDPS  360
VHSHLPKKVE QMRMQKLRMM ERAIFGTDI
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28340.12e-27GATA transcription factor 13